PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_44460
Common NameKK1_043076
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 156aa    MW: 17477.8 Da    PI: 4.4324
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_44460genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB79.54.4e-251194386
          NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
                   ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +v+se+++ c++e+r+ti+++ +l al+ lGf +y+e++ + 
  C.cajan_44460 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCNKEERRTIAPEHVLKALGVLGFGEYIEEVYAA 94
                   6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.5E-398140IPR009072Histone-fold
SuperFamilySSF471136.2E-3612143IPR009072Histone-fold
PfamPF008081.9E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MEPMDIVGKA KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCNKEERRTI APEHVLKALG VLGFGEYIEE VYAAYEQHKL ETMQDSLKGA KWSNRAEMTE  120
EEALAEQQRM FAEARARMNG GAITSKQPEA DQSLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-351213512133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4649060.0AF464906.1 Glycine max repressor protein (Dr1) mRNA, complete cds.
GenBankBT0898160.0BT089816.1 Soybean clone JCVI-FLGm-2L20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014494002.11e-112PREDICTED: protein Dr1 homolog
SwissprotP495921e-92NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A151QZZ71e-113A0A151QZZ7_CAJCA; Protein Dr1 isogeny
STRINGGLYMA05G07750.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.28e-94nuclear factor Y, subunit B13